Protein Info for mRNA_5125 in Rhodosporidium toruloides IFO0880

Name: 13493
Annotation: Interpro Protein of unknown function (DUF3431)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details PF11913: DUF3431" amino acids 398 to 599 (202 residues), 27.8 bits, see alignment E=1.1e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (611 amino acids)

>mRNA_5125 Interpro Protein of unknown function (DUF3431) (Rhodosporidium toruloides IFO0880)
MVAGAAVAFSLMFRVWEVRVGQERLCEAIEVFVLPAVLAFSPYIASTFSHGHSPSTASSA
LVMMAAASTFLVGFALIGVPASGVAAALALVRIPLDAVGLLLLKEGLSAENPALFLRDSV
STATTCSLLAIPVALFSSEADKSPSLNTGGIASLLLILLVSILSQLALLYNLTNTSLAIS
TASTLFPRNLLLLVWQSFGRESIPLRQNWMQVLLVYVFGTVGVTWADGDVWSAFVRWRKG
GGDAYSLLSESNGHAMSPSGSPPPNLRKQSSDRTSPHSSRSPSLLSLLPFFPLLIHLLTL
PVSYTSVSLACSYLPPSLRSTICPSSASAPTSRSVDLVIAYYDEALERTRDHINDVRKTP
FVRKRSNRVVLYNKGPKGEEEIRKGLGLRWTDEVVPLPNLGREGATYLTHILLHYNTTLS
SLLPSFHPSPPPASLLTPLSHLRTTHLADHTYFLQPHLAWGDIAAPRMRIVEDETGFAHF
GPLIRGECGFDKRVDVDFPTVKELFNIFAGEMCPPTGHLMAWSAQFAVSKRRILANPYAR
YSSLSSLLEAPSSHWIHNLWGPNDSGGPSNPAFGHSVERAWPVIFGCWDPQLAAECPDEV
AEKEKCQCLDT