Protein Info for mRNA_5148 in Rhodosporidium toruloides IFO0880
Name: 13516
Annotation: K17918 SNX3_12 sorting nexin-3/12
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to SNX3_CRYNJ: Sorting nexin-3 (SNX3) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
KEGG orthology group: None (inferred from 81% identity to scm:SCHCODRAFT_58926)Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (129 amino acids)
>mRNA_5148 K17918 SNX3_12 sorting nexin-3/12 (Rhodosporidium toruloides IFO0880) MYSAPENTLEIEVRDPRTQEFGRKMFTDYEIICRTNIPAFRIRYSSVRRRYSDFEAFRDI LERESQRVNIPPLPGKVFSGSRFSDEVIEQRREGLERFLQIVAGHPLLQTGSKVLCAFLQ DPSWNPANY