Protein Info for mRNA_5177 in Rhodosporidium toruloides IFO0880

Name: 13545
Annotation: K07874 RAB1A Ras-related protein Rab-1A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR00231: small GTP-binding protein domain" amino acids 9 to 164 (156 residues), 110.2 bits, see alignment E=4.5e-36 PF00025: Arf" amino acids 9 to 164 (156 residues), 62.8 bits, see alignment E=9e-21 PF00071: Ras" amino acids 10 to 170 (161 residues), 213.1 bits, see alignment E=5.4e-67 PF08477: Roc" amino acids 10 to 124 (115 residues), 123.4 bits, see alignment E=1.9e-39 PF04670: Gtr1_RagA" amino acids 10 to 127 (118 residues), 23 bits, see alignment E=1.4e-08 PF09439: SRPRB" amino acids 11 to 129 (119 residues), 22.1 bits, see alignment E=2.8e-08 PF01926: MMR_HSR1" amino acids 11 to 106 (96 residues), 22.5 bits, see alignment E=3e-08

Best Hits

Swiss-Prot: 76% identical to RAB1A_HUMAN: Ras-related protein Rab-1A (RAB1A) from Homo sapiens

KEGG orthology group: K07874, Ras-related protein Rab-1A (inferred from 85% identity to scm:SCHCODRAFT_84435)

Predicted SEED Role

"Pro-zeta-carotene desaturase, prolycopene producing (EC 1.-.-.-)" in subsystem Carotenoids (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>mRNA_5177 K07874 RAB1A Ras-related protein Rab-1A (Rhodosporidium toruloides IFO0880)
MQSEYDLLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELEGKTVKLQ
IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDADTFSNVKQWLQEIDRYACEGVNKLLVG
NKSDLASKKVVEYNVAKEFADQIGVSLLETSAKNATNVEQAFLTMAKQIKDRTAASAPAA
GGPGKAPVKLTGGAAVNQQQAGGCC