Protein Info for mRNA_5194 in Rhodosporidium toruloides IFO0880

Name: 13562
Annotation: K00002 AKR1A1, adh alcohol dehydrogenase (NADP+)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 40% identical to CADH6_ARATH: Probable cinnamyl alcohol dehydrogenase 6 (CAD6) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 58% identity to ani:AN5355.2)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

3-methylbutanol biosynthesis (engineered) (6/7 steps found)
ethanol degradation II (3/3 steps found)
pyruvate fermentation to ethanol II (2/2 steps found)
pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
superpathway of anaerobic sucrose degradation (14/19 steps found)
acetaldehyde biosynthesis I (1/1 steps found)
phytol degradation (3/4 steps found)
salidroside biosynthesis (3/4 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-methionine degradation III (2/3 steps found)
L-valine degradation II (2/3 steps found)
ethanol degradation I (1/2 steps found)
phenylethanol biosynthesis (3/5 steps found)
butanol and isobutanol biosynthesis (engineered) (5/8 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
pyruvate fermentation to ethanol I (1/3 steps found)
pyruvate fermentation to ethanol III (1/3 steps found)
(S)-propane-1,2-diol degradation (2/5 steps found)
acetylene degradation (anaerobic) (2/5 steps found)
ethanolamine utilization (2/5 steps found)
cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
heterolactic fermentation (11/18 steps found)
serotonin degradation (3/7 steps found)
mixed acid fermentation (9/16 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
superpathway of fermentation (Chlamydomonas reinhardtii) (3/9 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
superpathway of N-acetylneuraminate degradation (11/22 steps found)
noradrenaline and adrenaline degradation (4/13 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>mRNA_5194 K00002 AKR1A1, adh alcohol dehydrogenase (NADP+) (Rhodosporidium toruloides IFO0880)
MSSEVPAKFHGWCALGTDSIQGKFVWQEYEPKAFADDDVDIKIMYCGICASDLHTASGGW
GSVDYPQVVGHEILGEAVRVGSKVKHVKVGDIVGVGAQNDSCLECGQCKNNREQYCDVGQ
VGTYNGKYFREGPGKGAKSYGGYADYHRAPGHFVVKIPDGLDHAIAAPMLCGGVTVYSPL
VQYGAGKTAKDVGIVGIGGLGHFGLLFAKALGANVTAISHSESKKADAEKMGATRFIATH
SGSDDDFAPYKRSLDLIICTTNDTSMPLMGYLSLLRPGGNLILVGAPEKPVASDLPAFPF
IMGNVHLGGSAIGSPSTIKEMLELAAKQNIKSWIEKRPMEDVNQAVPDMHASKARYRYVL
VNTKNGGKL