Protein Info for mRNA_5194 in Rhodosporidium toruloides IFO0880

Name: 13562
Annotation: K00002 AKR1A1, adh alcohol dehydrogenase (NADP+)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF08240: ADH_N" amino acids 37 to 157 (121 residues), 84.4 bits, see alignment E=5.2e-28 PF00107: ADH_zinc_N" amino acids 199 to 326 (128 residues), 63 bits, see alignment E=2.9e-21

Best Hits

Swiss-Prot: 40% identical to CADH6_ARATH: Probable cinnamyl alcohol dehydrogenase 6 (CAD6) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 58% identity to ani:AN5355.2)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>mRNA_5194 K00002 AKR1A1, adh alcohol dehydrogenase (NADP+) (Rhodosporidium toruloides IFO0880)
MSSEVPAKFHGWCALGTDSIQGKFVWQEYEPKAFADDDVDIKIMYCGICASDLHTASGGW
GSVDYPQVVGHEILGEAVRVGSKVKHVKVGDIVGVGAQNDSCLECGQCKNNREQYCDVGQ
VGTYNGKYFREGPGKGAKSYGGYADYHRAPGHFVVKIPDGLDHAIAAPMLCGGVTVYSPL
VQYGAGKTAKDVGIVGIGGLGHFGLLFAKALGANVTAISHSESKKADAEKMGATRFIATH
SGSDDDFAPYKRSLDLIICTTNDTSMPLMGYLSLLRPGGNLILVGAPEKPVASDLPAFPF
IMGNVHLGGSAIGSPSTIKEMLELAAKQNIKSWIEKRPMEDVNQAVPDMHASKARYRYVL
VNTKNGGKL