Protein Info for mRNA_5242 in Rhodosporidium toruloides IFO0880

Name: 13610
Annotation: K02932 RP-L5e, RPL5 large subunit ribosomal protein L5e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF17144: Ribosomal_L5e" amino acids 34 to 196 (163 residues), 280.2 bits, see alignment E=5.8e-88 PF14204: Ribosomal_L18_c" amino acids 212 to 308 (97 residues), 110.4 bits, see alignment E=6.8e-36

Best Hits

Swiss-Prot: 68% identical to RL5A_SCHPO: 60S ribosomal protein L5-A (rpl501) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02932, large subunit ribosomal protein L5e (inferred from 75% identity to cnb:CNBC1810)

Predicted SEED Role

"LSU ribosomal protein L5e (L18p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>mRNA_5242 K02932 RP-L5e, RPL5 large subunit ribosomal protein L5e (Rhodosporidium toruloides IFO0880)
MPFVGQFTAPRPKTQLTRLQRAQVKEQKNSAYFSRYQVKYRRRREGKTDYYARKRLVVQA
KNKYASPKYRLVVRITNKDVICQIVSAKLQGDVVLAAAYSHELPRYGIKHGLTNWAACYA
TGLLCARRALTKLGLADKYEGVTEPSGELELTEPIEGEPRPFKCFLDVGVARTSTGARVF
GAMKGASDGGVFIPHSEQRFPGFDPESKELDAETLQRYIYGGHVAEFMETLEEEDDERFK
KHFSTYLEDDISSEDIEDMYREAHEKIREDPTYTKTDKADLAAWKEASKKTHPKKLSTAE
RKERVKAKKEAWLASRE