Protein Info for mRNA_5246 in Rhodosporidium toruloides IFO0880

Name: 13614
Annotation: K00411 UQCRFS1, RIP1, petA ubiquinol-cytochrome c reductase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF02921: UCR_TM" amino acids 98 to 149 (52 residues), 43.6 bits, see alignment 3.5e-15 TIGR01416: ubiquinol-cytochrome c reductase, iron-sulfur subunit" amino acids 120 to 278 (159 residues), 193.2 bits, see alignment E=1.9e-61 PF00355: Rieske" amino acids 210 to 264 (55 residues), 39.7 bits, see alignment E=4e-14

Best Hits

KEGG orthology group: K00411, ubiquinol-cytochrome c reductase iron-sulfur subunit [EC: 1.10.2.2] (inferred from 58% identity to cci:CC1G_10506)

Predicted SEED Role

"Ubiquinol-cytochrome C reductase iron-sulfur subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>mRNA_5246 K00411 UQCRFS1, RIP1, petA ubiquinol-cytochrome c reductase iron-sulfur subunit (Rhodosporidium toruloides IFO0880)
MSLTRKAITLAPSAYSLASGVPAARALNLAAKGEPAAHGHGGHGAAGPRADKPAAFAGRT
TVGPFGITSQSRVNASAVSLFQSRSLSTSAKTLDAASQVPDFSKYTKATNPDSGRAFSYF
MVGTMGLVTAAGAKSTVTDFLTNMSASSDVLALAKVEVDLSTIPEGKNVIIKWRGKPVFI
RHRTAGEIEEANKVDVSKLRDPQKDSERVKKPEWLIMLGVCTHLGCVPIGEAGDYGGWYC
PCHGSHYDISGRARKGPAPLNLEIPEYDFPEDSKVVIG