Protein Info for mRNA_5289 in Rhodosporidium toruloides IFO0880

Name: 13657
Annotation: K00344 qor, CRYZ NADPH2-quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF08240: ADH_N" amino acids 39 to 115 (77 residues), 39.1 bits, see alignment E=9.4e-14 PF00107: ADH_zinc_N" amino acids 160 to 286 (127 residues), 88.4 bits, see alignment E=6.2e-29 PF13602: ADH_zinc_N_2" amino acids 193 to 335 (143 residues), 47.9 bits, see alignment E=4.4e-16

Best Hits

Swiss-Prot: 42% identical to QOR_YEAST: Probable quinone oxidoreductase (ZTA1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 46% identity to fgr:FG05690.1)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>mRNA_5289 K00344 qor, CRYZ NADPH2-quinone reductase (Rhodosporidium toruloides IFO0880)
MSTSSTNLPSKMRAANITEQGDFDVIQIRELDVPKPAQGQVLYKVDYGGVNMWDTYARSG
VYKPGIPFTLGNESAGEVVAVGEGVEGFKAGDKVAAYTTGGGFADYCIAPADKLVKLPEG
TSTRDAATVLLQGLTALTFVKEAHEVKPGQFILIHAAAGGLGLLLVQLCKHLGATVIGTT
STQEKADIAKKAGADHVLLYGEGRDIVSEIYKITGGGIDRGVHAVFDGVGKDTFDMDFDL
VRRKGTIITLGNASGPVPPFAPLKLAPKNLKVCRPVLNQYVHTREEFQTYSTELFKLVKD
GHLKLAVHAEYPFTADGVKQAQKDISDRKTSGKLLIKVA