Protein Info for mRNA_5321 in Rhodosporidium toruloides IFO0880

Name: 13689
Annotation: K11108 RCL1 RNA 3'-terminal phosphate cyclase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03400: 18S rRNA biogenesis protein RCL1
  • amino acids 26 to 410 (385 residues), 436.8 bits, E=2.7e-135
• PF01137: RTC
  • amino acids 28 to 364 (337 residues), 158.1 bits, E=2.1e-50
• PF05189: RTC_insert
  • amino acids 203 to 309 (107 residues), 115 bits, E=2.2e-37

Best Hits

Swiss-Prot: 51% identical to RCL1_HUMAN: RNA 3'-terminal phosphate cyclase-like protein (RCL1) from Homo sapiens

KEGG orthology group: K11108, RNA 3'-terminal phosphate cyclase-like protein (inferred from 52% identity to mgl:MGL_1996)

Predicted SEED Role

No annotation

Protein Sequence (412 amino acids)

>mRNA_5321 K11108 RCL1 RNA 3'-terminal phosphate cyclase-like protein (Rhodosporidium toruloides IFO0880)
MAGQRLPPPSASSSSTPAPTSSSRVLHFTGHSRFRHRLILSLLSRRPVRIDRIRPNDDNP
GLRVYEVSFLRLVEKLTQGSRVEISYTGTSVLFHPGTIQNGQITHQCPLERGVGWFLEPL
LAIAPFGKKDLSLTLRGVTTDGRDASVDVVRTSGLPHLAMFLDKEGVELRITKRGHPPLG
GGEVTLTCPSVRSIKSGFEFTSLGRISKIRGIAHSVRVSPQLANRLVASARSVLNRYIPD
IYIYTDVYRGEDSGKSPGYAITLVASSTSHVLHSSESSSCPSPSSSSSSTPQTPEDLGIL
AARALLSQIARGGCVDRGWEWLVTTLLVLGGEDVGKVRAAGPLDAALIAHLRDLKAFFGT
TFKIKPVSSLPSLPSAGDDDADAEATGAGKEREEFVLSCVGTGFVNTARRAG