Protein Info for mRNA_5336 in Rhodosporidium toruloides IFO0880

Name: 13704
Annotation: K14777 DDX47, RRP3 ATP-dependent RNA helicase DDX47/RRP3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 284 to 304 (21 residues), see Phobius details PF00270: DEAD" amino acids 78 to 245 (168 residues), 162.9 bits, see alignment E=1e-51 PF04851: ResIII" amino acids 98 to 223 (126 residues), 28.1 bits, see alignment E=3e-10 PF00271: Helicase_C" amino acids 280 to 388 (109 residues), 102.2 bits, see alignment E=3.4e-33

Best Hits

Swiss-Prot: 67% identical to RRP3_CRYNB: ATP-dependent rRNA helicase RRP3 (RRP3) from Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)

KEGG orthology group: K14777, ATP-dependent RNA helicase DDX47/RRP3 [EC: 3.6.4.13] (inferred from 67% identity to cnb:CNBH2720)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>mRNA_5336 K14777 DDX47, RRP3 ATP-dependent RNA helicase DDX47/RRP3 (Rhodosporidium toruloides IFO0880)
MPDSEAGSSASGSRSPSPAPHPPTTTSSSSSAQPIASSSKALPLLSTEPTSSTTFSDLGL
LPELCTACTQLGFKQPSEIQRECIPYALEGRDIIGLAQTGSGKTAAFALPILHALWQDPQ
GLFAVVLAPTRELAYQISDQFTALGSGIGVRVATIVGGMDTMAQQVALAKKPHIVVATPG
RLQDHLENTKGFSLRNLKYLVMDEADRLLDLDFGPVIDKILKVIPREGRRTYLFSATMTT
KVAKLQRASLRDPVKLEVSSKYQTVSTLLQYYFLVPLKHKDLHLVHLLHTLSGLTAIVFV
RTVVDAQRLSILLRLLSFPAIPLHGQLSQSARLGALNKFKSGGKTIMIATDVASRGLDIP
SVDLVVNYDLPTNSKDYIHRVGRTARAGRSGKSVTLVTQYDVELFQRIEGVIGKKMDEYP
LGASGKQEALLLSERVGEAQREAIKEVKEFQMGHGGAKGKGKRRRDDDERDRDDDEREAG
MPVKRGGGRGGRGGGRGGKRGRR