Protein Info for mRNA_5379 in Rhodosporidium toruloides IFO0880

Name: 13747
Annotation: K12829 SF3B2, SAP145, CUS1 splicing factor 3B subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 PF04037: DUF382" amino acids 157 to 283 (127 residues), 199.2 bits, see alignment E=2.4e-63 PF04046: PSP" amino acids 292 to 337 (46 residues), 68.2 bits, see alignment 4.6e-23

Best Hits

KEGG orthology group: K12829, splicing factor 3B subunit 2 (inferred from 60% identity to cci:CC1G_10184)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>mRNA_5379 K12829 SF3B2, SAP145, CUS1 splicing factor 3B subunit 2 (Rhodosporidium toruloides IFO0880)
MANAAVASSSPAINGTAPVKTSSKSRGQLKRLKKKAKATANGEQADKQADRDDRPLERPP
TQEPESADEDVKVKLEEDAAGSGIPDAFAHVFAHFQIPADAVKAEDGRDGATDEKGQVIY
SDDEMPSEDDEEPAELSKRKQRKANRLSVAELKRLVKKPEVVEWVDVSASDPKLLVQIKS
HRNTIPVPPHWSQKRDYLQGKRGLEKPAFQLPSFIADTGIATQRDAVKEKEEGQSLKQKT
RERVQPKMGKIDIDYQKLHDAFFKYQTKPKMTEFGEVYYEGKEYETKLKEKKPGELSDEL
KEALSIPPLAPPPWLISMQRYGPPPSYPTLRIPGLNAPIPEGAAWGFHPGGWGKPPLDEY
GRPLYGDIYGVAPRQDANQPGEPIEREPWGELEPDEEVSEEEEEEEEEEEEEEEQAAPAD
GLQTPSGLETPSGMASVTSTVPGGLETPDFLELRKRREETEQSEVDTGPKQLYQVVPERE
ARMRGFMGSDRVYDVSSLGNAAPPPVLGQEERGTKRKAGGVDVALDAADLEGLSEADLRA
RYEQATKAGRTHHEDFSDFVGEEVAKRRRIADKKKSESAKEKFKF