Protein Info for mRNA_5429 in Rhodosporidium toruloides IFO0880

Name: 13797
Annotation: K01067 E3.1.2.1, ACH1 acetyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 PF02550: AcetylCoA_hydro" amino acids 22 to 243 (222 residues), 165.3 bits, see alignment E=1.8e-52 PF13336: AcetylCoA_hyd_C" amino acids 346 to 494 (149 residues), 144.1 bits, see alignment E=3.5e-46

Best Hits

Swiss-Prot: 67% identical to ACH1_NEUCR: Acetyl-CoA hydrolase (acu-8) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K01067, acetyl-CoA hydrolase [EC: 3.1.2.1] (inferred from 74% identity to scm:SCHCODRAFT_69884)

MetaCyc: 61% identical to acetyl-CoA hydrolase (Saccharomyces cerevisiae)
Acetyl-CoA hydrolase. [EC: 3.1.2.1]

Predicted SEED Role

"Acetyl-CoA hydrolase/transferase family protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>mRNA_5429 K01067 E3.1.2.1, ACH1 acetyl-CoA hydrolase (Rhodosporidium toruloides IFO0880)
MLPTKALRSVQPSAALKARVPRESYLRKLARPEDLVPLFKNHDYCGWSGFTGVGYPKETP
AALAEHVEKNNLQGKMRFSLFVGASTGPEVEERWARNLMIERRFPHQVGKAISKGINAGE
IDFADKHLSMFAQDLTYGYYSRDKKHGEPGKMLDWAWVEATEILPDGSIVPGASVGATPE
ILASAEKIIVEVNTGLPSMKGLHDIVISQDPPHRLPYLVTHPADRIGTVSIPVDPERVVA
IVETNKPDNTGKNAPETEDSKKIAGHLINFFEEEVAAGRMPKNLLPLQSGIGNVANSIIG
GLKESKFERMQVWTEVLQDTFLPLLKSGKLDFATATSIRFSPDIFKEFYRDWDDYVDKLL
LRPQQVANSPEIIRRLGVIAMNTPLEVDIYAHANSTNALGSRMLNGIGGSADFLRNAKLS
IMHTPSARPSKTDPTGISCIVPFATHVDQTEHDLDVIVTEQGLADLRGLSPRQRAPIIIE
KCAHPEYREQLLEYYDRSLHECLKKGAAHEPHMLRNAFRMHLNLEEKGTMKLSGWS