Protein Info for mRNA_5462 in Rhodosporidium toruloides IFO0880

Name: 13830
Annotation: HMMPfam-Bacteriorhodopsin-like protein-PF01036,PRINTS-Bacterial opsin signature-PR00251,ProSitePatterns-Bacterial rhodopsins signature 1.-PS00950,SMART-Bacteriorhodopsin-like protein-SM01021,SUPERFAMILY--SSF81321

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 128 to 158 (31 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details PF01036: Bac_rhodopsin" amino acids 28 to 159 (132 residues), 79.5 bits, see alignment E=1.4e-26 amino acids 173 to 224 (52 residues), 31.9 bits, see alignment 5.4e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>mRNA_5462 HMMPfam-Bacteriorhodopsin-like protein-PF01036,PRINTS-Bacterial opsin signature-PR00251,ProSitePatterns-Bacterial rhodopsins signature 1.-PS00950,SMART-Bacteriorhodopsin-like protein-SM01021,SUPERFAMILY--SSF81321 (Rhodosporidium toruloides IFO0880)
MGNNALALNPKKTRANIDITTHASDWLWAVFAVMALSSIAILAWGHLKRPVGERAFHELA
AALCFTASIAYFAMASDLGSTAIPVEFIRSGTRGANWVSQGVTRPTRSIWYARYIDWTIT
TPLLLLELLLVTGLPLSQIFSVIFFDLVMIETGLIGALRLGTDFHKSYSTGALYLSLLWL
VYPTIWGVADGGNYIAPTSEMVAYGVLNILAKPVFSVVHLLSLSRLDYARLGMSSSKVSD
GAHQNLLNEKMGPNSTSATPRASTVASPNAGTYGDGSHFHGSAGTGMGVGNGVGTGAGTV
GDGSHFHRGGNAAAVV