Protein Info for mRNA_5549 in Rhodosporidium toruloides IFO0880

Name: 13917
Annotation: K00027 ME2, sfcA, maeA malate dehydrogenase (oxaloacetate-decarboxylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00390: malic
  • amino acids 144 to 324 (181 residues), 216.3 bits, E=3e-68
• PF03949: Malic_M
  • amino acids 334 to 597 (264 residues), 306 bits, E=2e-95

Best Hits

Swiss-Prot: 46% identical to MAO11_PHOPR: NAD-dependent malic enzyme 1 (maeA1) from Photobacterium profundum (strain SS9)

KEGG orthology group: K00027, malate dehydrogenase (oxaloacetate-decarboxylating) [EC: 1.1.1.38] (inferred from 52% identity to scm:SCHCODRAFT_74986)

Predicted SEED Role

"NAD-dependent malic enzyme (EC 1.1.1.38)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP (EC 1.1.1.38)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (13/14 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• L-malate degradation II (1/1 steps found)
• chitin deacetylation (3/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• reductive TCA cycle I (7/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• L-carnitine degradation II (1/3 steps found)
• methylgallate degradation (2/6 steps found)
• mixed acid fermentation (9/16 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
• methylaspartate cycle (9/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)
• syringate degradation (3/12 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.38

Use Curated BLAST to search for 1.1.1.38

Protein Sequence (634 amino acids)

>mRNA_5549 K00027 ME2, sfcA, maeA malate dehydrogenase (oxaloacetate-decarboxylating) (Rhodosporidium toruloides IFO0880)
MHRSLLVAAAGSKRPRTAASSLAAARRAFQSAAHVENKLRLQVKEADEEGAALHDSTISN
KEYLQHSKNERPIWTALRGRALLNEPALNKGAGFTPEERDTFGLTGLLPHEVHSLDQQCK
RAYSQLQERPSALAKYTFLSSLRDQNIILFYALCLRHLNELLPVIYTPTVGEAIQKYSTI
WRRPDGLFLSYAHRHKMREMMMQAKRPKDVDLIIVTDSEGILGIGDQGVGGILIAQGKAN
LYTLGAGIDPSRILSVVLDVGTDNSALLNDPLYLGLRRKRVRGAEYDKFVDRFCELVREE
YPQALLHFEDFGVSNASKILTTYRNKQSVFNDDMQGTAAVVLAALLSAVKVTKSELKDQR
IVVFGFGTAGYGIADGIRNALMLEAGLSSEEVRKIFWCVDRPGLLTTEHSPTLRPGQEHF
IRNASEVSSWERDAEGRISLLEVVKQAKPTILIGCSTMSGAFDEEVVREMAKHVERPIVF
PLSNPTKLAEADPADINEWTNGLALMATGSPFPPVKTPRGKEHKIAEANNGLLYPGLGLG
VIVSRASFLTEKMITAGVAALAKMAPALDDPDESLLPPLSDLRHVSVKVATAVANAAKEE
GVSQIKRDDPFSQDEVRAAQWDPVYRPLELVDRH