Protein Info for mRNA_5562 in Rhodosporidium toruloides IFO0880

Name: 13930
Annotation: KOG0257 Kynurenine aminotransferase, glutamine transaminase K

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF00155: Aminotran_1_2" amino acids 36 to 390 (355 residues), 153.3 bits, see alignment E=1.6e-48 PF01053: Cys_Met_Meta_PP" amino acids 107 to 218 (112 residues), 20.7 bits, see alignment E=2.1e-08 PF01041: DegT_DnrJ_EryC1" amino acids 110 to 214 (105 residues), 25 bits, see alignment E=1.8e-09

Best Hits

KEGG orthology group: None (inferred from 46% identity to ppl:POSPLDRAFT_92949)

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>mRNA_5562 KOG0257 Kynurenine aminotransferase, glutamine transaminase K (Rhodosporidium toruloides IFO0880)
MDFAYALNPYVRDSAAPPIPLAGQWGARFPSTPEKPLLNLAQGVPGSPPPPELQKKLAEA
AAEPATTSYGALQGDEGLRRALAKDVNGVYGTSSAGEGQPVTADDIVITAGCNLAFYASM
LALARPGDEIILPSPWYFNHSMTLDQLGLTLVPLRCQPPNFLPSIEECEILITPRTKALV
LVSPNNPTGAVYPPDLLKQFAELAEEKKIALVLDETYRDFLEERPHNLFAETNWRRYLIH
LFSFSKSYAIPGHRLGAIIASQPFLTSVYKLMDCIQTCPPRPTQRALEWAIEATRPWREA
TRDELAQRQRVFKELLEGVEGWEVVSGGAYFAYVKHPYAGVPSEVVAKRLGEYVGVVVLP
GTFFSPPFENVDEDRYIRFAVANVSEETLRLVPARLEELNKLWPTLQE