Protein Info for mRNA_5626 in Rhodosporidium toruloides IFO0880

Name: 13994
Annotation: KOG1611 Predicted short chain-type dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00106: adh_short" amino acids 57 to 185 (129 residues), 63 bits, see alignment E=2.7e-21 PF13561: adh_short_C2" amino acids 57 to 223 (167 residues), 68.4 bits, see alignment E=7.1e-23

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>mRNA_5626 KOG1611 Predicted short chain-type dehydrogenase (Rhodosporidium toruloides IFO0880)
MATTSTVYVISGASRGVGFAITSLLAQRKDVLIFAGTRDTAKSVQLNELAQKNDKVIQVK
LEKVDFLIANAGIADVNKPVLETPTTSFLNQFTVNALGPLVLFQHFYPLLAKSSAPRFFV
TSSRAGSTSDVPQSKFTLSAYGVSKAAANHLVAHIAREHGEKDGLVAAVVHPGFVGTDMA
KAAMEAVGLTLDAQIPGIQMLTPDESAAALVKIYDEAKRETHGGRFFSYDGSQIPW