Protein Info for mRNA_5663 in Rhodosporidium toruloides IFO0880

Name: 14031
Annotation: K15441 TAD2, ADAT2 tRNA-specific adenosine deaminase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14437: MafB19-deam
  • amino acids 11 to 67 (57 residues), 35.6 bits, E=7.4e-13
  • amino acids 108 to 149 (42 residues), 31.8 bits, 1.1e-11
• PF00383: dCMP_cyt_deam_1
  • amino acids 12 to 144 (133 residues), 81.2 bits, E=4.6e-27

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.-

Protein Sequence (252 amino acids)

>mRNA_5663 K15441 TAD2, ADAT2 tRNA-specific adenosine deaminase 2 (Rhodosporidium toruloides IFO0880)
MVPREMQDDQNLAFMDQAVVMAEEALAAREIPVGCVLVHDGKVVARGRNRTNEGRNATLH
AEFDALRHLLPDRSHAQTPGLTRPYTPQAEDVIAAAAEKEGPVARGRKIWQTPLKGVVLY
VTVEPCLMCASAMRQVGIEKVVYGCANDRFGGTGGVQSIHSDPRLLYAPPYPAVGGYRRE
EAIMLLRRFYISENSTAPKPKKKSNRVLKTEIPGVVSTPSSPASSLSRTSTPALYPEPTS
APVNLPPPVPAV