Protein Info for mRNA_5665 in Rhodosporidium toruloides IFO0880

Name: 14033
Annotation: K15083 RAD16 DNA repair protein RAD16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 PF00176: SNF2_N" amino acids 82 to 258 (177 residues), 163.5 bits, see alignment E=2.4e-51 amino acids 292 to 404 (113 residues), 24 bits, see alignment E=6.1e-09 PF04851: ResIII" amino acids 82 to 237 (156 residues), 28.9 bits, see alignment E=4.4e-10 PF00270: DEAD" amino acids 89 to 216 (128 residues), 26.1 bits, see alignment E=2.8e-09 PF13639: zf-RING_2" amino acids 426 to 468 (43 residues), 28.9 bits, see alignment 4.9e-10 PF13920: zf-C3HC4_3" amino acids 426 to 471 (46 residues), 30.7 bits, see alignment 9.5e-11 PF13923: zf-C3HC4_2" amino acids 427 to 468 (42 residues), 31.9 bits, see alignment 3.7e-11 PF00097: zf-C3HC4" amino acids 427 to 468 (42 residues), 34.1 bits, see alignment 8e-12 PF00271: Helicase_C" amino acids 505 to 619 (115 residues), 57.9 bits, see alignment E=4.8e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (676 amino acids)

>mRNA_5665 K15083 RAD16 DNA repair protein RAD16 (Rhodosporidium toruloides IFO0880)
MSHVRSLSHRLFLYCADGLPRQFERTTYYLGKNHPELKTCWPDLAERPLTKVERAEQPAL
LTQKLLPFQLEGLNWLKQQEAGPFKGGFLCDEMGMGKTIQTISLILSDWSPTHPKGSTLV
LAPTVAIMQWKSEIEKFTTGFKVLVFHGSNRLSNAKEMEKFDVVLTSYAVLESTFRREQK
GFTKKGKVLKEDSILHKVKWHRVILDEAHNIKDRQSNTAKAAFALRAHYRWCLSGTPLQN
RVGELYSLIRFVGCDPFAFYFCKRCDCKSLHWLASGGPCSACGHSSMQHTCYWNQAVLTP
IQYGGTTTGEGQRAFQKMSLLLSHLMLRRTKVERADDLGLPPRVVNVRRDFFTEEEEELY
QSLFKDVKRKFNTYADEGTVLNNYSNIFTLITRMRQMADHPDLVIKSKTAEPVQHAAADL
PQEIITCRLCLDEAEDAVKTSCRHIFCRECVRQYLETAVEQKPECPVCHLPMSIDLDQDA
IEVDETGRQGFLARIDPTKSRTSSKIEALLEELSKTRTEDRTLKTLVFSQFTSMLDLVAR
RLQLSGFKYVRLAGTMTPLARENTIKHFTSDPECTVFLISLKAGGVALNLVEASRVIILD
PWWNPAVELQAMDRVHRIGQHRPITVTRLIIENSIESRILDLQKKKEDLAASALGDDDAA
MGRLTPEDLSYLFSLS