Protein Info for mRNA_5669 in Rhodosporidium toruloides IFO0880

Name: 14037
Annotation: K01736 aroC chorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00033: chorismate synthase
  • amino acids 8 to 366 (359 residues), 471.5 bits, E=7.3e-146
• PF01264: Chorismate_synt
  • amino acids 8 to 365 (358 residues), 470.8 bits, E=8.8e-146

Best Hits

Swiss-Prot: 70% identical to AROC_SCHPO: Chorismate synthase (SPCC1223.14) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01736, chorismate synthase [EC: 4.2.3.5] (inferred from 75% identity to ppl:POSPLDRAFT_88936)

Predicted SEED Role

"Chorismate synthase (EC 4.2.3.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (16/18 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (28/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.5

Protein Sequence (369 amino acids)

>mRNA_5669 K01736 aroC chorismate synthase (Rhodosporidium toruloides IFO0880)
MSTFGTLFRVTTYGESHCASVGAIIDGCPPGMPLTNEDIQPQMTRRRPGQSNLTTPRNEA
DAVQIQSGVEAGVTLGTPIGLLVRNKDQRPHDYTETDHYPRPSHADWTYLLKYGLKASSG
GGRSSARETIGRVAAGTIAERYLKLAYGVEIVAFVSSVGKVHMPESSTDSDLLSEDYLKL
LSTITREKVDENTIRCPHAETAQAMEERIMAAKARNDSIGGTVTCVIRRSPVGLGEPVFD
KLEAKLAHAMLSIPATKGFEIGSGFKGTEVPGSEHNDAFVKKADGSLGTKTNRSGGIQGG
ITNGEDIYFKIAFKSPATISQEQATAKYDGESGVLATRGRHDPCVVPRAVPIVEAMAALV
IMEYVVCSV