Protein Info for mRNA_5690 in Rhodosporidium toruloides IFO0880

Name: 14058
Annotation: K17710 PTCD1 pentatricopeptide repeat domain-containing protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 785 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13812: PPR_3" amino acids 161 to 208 (48 residues), 22.8 bits, see alignment 2e-08 amino acids 224 to 270 (47 residues), 20 bits, see alignment 1.5e-07 TIGR00756: pentatricopeptide repeat domain" amino acids 169 to 201 (33 residues), 21.7 bits, see alignment (E = 7.8e-09) amino acids 202 to 236 (35 residues), 28.3 bits, see alignment (E = 6.1e-11) PF01535: PPR" amino acids 169 to 196 (28 residues), 14.7 bits, see alignment (E = 7.4e-06) amino acids 202 to 232 (31 residues), 17.9 bits, see alignment (E = 7.4e-07) amino acids 600 to 624 (25 residues), 16.9 bits, see alignment (E = 1.5e-06) amino acids 678 to 698 (21 residues), 11.8 bits, see alignment (E = 6.5e-05) PF13041: PPR_2" amino acids 169 to 211 (43 residues), 32.2 bits, see alignment 2.4e-11 amino acids 199 to 246 (48 residues), 41.5 bits, see alignment 3e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (785 amino acids)

>mRNA_5690 K17710 PTCD1 pentatricopeptide repeat domain-containing protein 1 (Rhodosporidium toruloides IFO0880)
MRRAAATAVRTALSARPPAARTAPVALPLPRPFSSSSTSHFFFRRPQKTRSQLRQELLDA
AARGQPEVVGKLYPQFAQLAHPSTDSSERPRLWRKEAQALLRLVAQAGHFGTALRIFNDL
EALYDSPPQLAEHQLLLLAMVNSNRHAKAVEWIESLESSYGLRPEPSEWNVVLQGFRQQG
DVEGMLDVVRRMRTSGASPDIVTYNTLIAGLLAARRLDLARATVQEMEAEGVQPNVMTST
TLLVGFLDAGELASAREVHNRLLETAGLPNRLSSKGKGKGTYREDQPVEVDVPVVNALMR
YETVVNGLDAALSFAERCRDSGVPLDGYTINTLVKAGVREIRSADGGARLVERLENITGA
QSDRRTWSVLVSHLARGGGSVDEALKLYYKARDRFVEPDSAMVQPLLDALLKPAPAAETL
AQAKVLYEDLVSGARSYRNKPDSSIFATLLRACAHQDCTDLDWSLSLVQDMRDRSVRLDP
LSVGWHIVAMMRSAPSFEDAFKAYDEMRALDPSVLDAKAFNTILHAFTTLRADTGEAAPS
VYINEFLTDMIRSGHPPESATYSLLLQHYSRIAEPSFEMIKQLHSRIKLDANLDPDTPLF
NSLMDAYSRVGAFDRAYGVWDSMLLNLSGRIKPDQISVSILLDTCGRDGYMGGKQRGMRL
WQDLERGTLPVVRNYKIWESWVEALCRWGMFDEAEKVVFEEMGRPPANAVGTGAQVAPKP
TVATVEMLLKFARWTTSDGEERARVVAERIKAELPELWEHLPASAKALGRPQEQQVEGGG
ADVSS