Protein Info for mRNA_5692 in Rhodosporidium toruloides IFO0880

Name: 14060
Annotation: K07342 SEC61G, SSS1, secE protein transport protein SEC61 subunit gamma and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 69 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details PF00584: SecE" amino acids 12 to 65 (54 residues), 56.1 bits, see alignment E=1.4e-19 TIGR00327: protein translocase SEC61 complex gamma subunit, archaeal and eukaryotic" amino acids 12 to 66 (55 residues), 63.3 bits, see alignment E=7.1e-22

Best Hits

Swiss-Prot: 53% identical to SC61G_NEUCR: Probable protein transport protein Sec61 subunit gamma (9G6.310) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K07342, protein transport protein SEC61 subunit gamma and related proteins (inferred from 65% identity to lbc:LACBIDRAFT_170758)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (69 amino acids)

>mRNA_5692 K07342 SEC61G, SSS1, secE protein transport protein SEC61 subunit gamma and related proteins (Rhodosporidium toruloides IFO0880)
MDAVRDLTSSGKSFVKDGQQFMNKCTKPDQKEYLQICRAVAIGFAMMGGIGYLVKLIHIP
INNILVGGA