Protein Info for mRNA_5720 in Rhodosporidium toruloides IFO0880

Name: 14088
Annotation: K04392 RAC1 Ras-related C3 botulinum toxin substrate 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 TIGR00231: small GTP-binding protein domain" amino acids 1 to 157 (157 residues), 128.7 bits, see alignment E=9.3e-42 PF00025: Arf" amino acids 2 to 171 (170 residues), 28.4 bits, see alignment E=1.7e-10 PF08477: Roc" amino acids 5 to 119 (115 residues), 78 bits, see alignment E=1.1e-25 PF00071: Ras" amino acids 5 to 177 (173 residues), 186.1 bits, see alignment E=5.5e-59

Best Hits

Swiss-Prot: 82% identical to RAC1_BOVIN: Ras-related C3 botulinum toxin substrate 1 (RAC1) from Bos taurus

KEGG orthology group: K04392, Ras-related C3 botulinum toxin substrate 1 (inferred from 82% identity to uma:UM00774.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>mRNA_5720 K04392 RAC1 Ras-related C3 botulinum toxin substrate 1 (Rhodosporidium toruloides IFO0880)
MQSIKTVCVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSVVSPPSFENVRTKWYPEICHHAPNIPIILVGTKLDLR
EDRETIEKLRERRMAPIAYQQAAAMAREIGAVRYIECSALTQKGLKNVFDEAIRAVLAPA
PREKKKSKGCVVC