Protein Info for mRNA_5728 in Rhodosporidium toruloides IFO0880

Name: 14096
Annotation: K03644 lipA lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16881: LIAS_N
  • amino acids 11 to 105 (95 residues), 75.2 bits, E=5.5e-25
• TIGR00510: lipoyl synthase
  • amino acids 64 to 355 (292 residues), 408.2 bits, E=1.1e-126
• PF04055: Radical_SAM
  • amino acids 128 to 288 (161 residues), 56.1 bits, E=6.2e-19

Best Hits

Swiss-Prot: 66% identical to LIPA_COPC7: Lipoyl synthase, mitochondrial (CC1G_03624) from Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 66% identity to cci:CC1G_03624)

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation II (1/2 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Protein Sequence (388 amino acids)

>mRNA_5728 K03644 lipA lipoyl synthase (Rhodosporidium toruloides IFO0880)
MLPRRTVAASVRTLATAVSPQPSTSATPHRPRLEKLRQDTAQIDDFLTTEPAPASARGRV
SFAKNKTPRLPDYLKTEIPTSASFNKIKQDLRGLKLHTVCEEARCPNIGQCWGGDKGDAT
ATIMLMGDTCTRGCRFCAIKTSRAPPPLDVHEPENTAEAISRWGVGYIVMTSVDRDDLPD
GGAAHIAETVRRTKAKAPHILIEALTPDFAGNPEAISLVAQSGLDVFAHNMETVESRTPF
VRDPRAKYRQSLEVLRLAKEAKEGLITKTSLMLGVGETDEEIMQTLKDLRDNNVDVVTFG
QYMRPTKRHMKVSSYITPEKFDFWAKQAEDLGFLYWASGPLVRSSFKANELLKSSAGKRL
LQGLQGRDRGVEAITKEGGRQIIEGVRV