Protein Info for mRNA_5761 in Rhodosporidium toruloides IFO0880

Name: 14129
Annotation: K14997 SLC38A11 solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 179 to 201 (23 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details amino acids 405 to 428 (24 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details amino acids 489 to 513 (25 residues), see Phobius details amino acids 518 to 536 (19 residues), see Phobius details amino acids 548 to 569 (22 residues), see Phobius details PF01490: Aa_trans" amino acids 177 to 568 (392 residues), 229.1 bits, see alignment E=4.2e-72

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>mRNA_5761 K14997 SLC38A11 solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 11 (Rhodosporidium toruloides IFO0880)
MADDLLAPTPRGPPAQFALDATDSPGPTPAATPPSHSRSSSSLIPPPPASPARTPAPVRS
ASSYGTATRDAQPGMSLFRYSDDEDELIASGPYERSRSADYYPPKPLASSTSSREVHFDM
DSEEIDDRDLDTPLMEGLVHTGLRRQSLDLRGEARRLKEMEVEGEEAEPPDWLSRGGGIF
AGIANMSNSILGAGIIGLPYALREAGFLTGILLLIFLGVVTDWTIRLIVLNAKMSGRRSY
IDILDSCFGKPGRAAVSFFQFAFAFGGMCAFCVILGDTIPRVLLALVGPDTSSVVSFFIS
RPIVTTVLTIGISYPLSLFRDIEKLSHASTLALISMVVIVVSVGVRGPGVEDSLKGDPSQ
RWTTLEPGVFGAISVISFAFVCHHNSLLIYGSLRTPTLDRFARVTHISTTLSVIACLCMS
ISGFLVFTDRTQGNILNNFAEDDMLINIARACFGLNMFTTLPLEAFVCREVAETYFWPDD
LVFNKRRHVLITTALVFSALVVSLITCDLGFILELAGGFSATALAYLFPAACFLRLSGSG
RQLAPQRVAAWACAAFGVLVMVLSTFLSIRKALTGEAHKQC