Protein Info for mRNA_5778 in Rhodosporidium toruloides IFO0880

Name: 14146
Annotation: HMMPfam-bZIP transcription factor-PF00170,HMMPfam-Transcription factor PAP1-PF08601,ProSitePatterns-Basic-leucine zipper (bZIP) domain signature.-PS00036,ProSiteProfiles-Basic-leucine zipper (bZIP) domain profile.-PS50217,SMART-basic region leucin zipper-SM00338,SUPERFAMILY--SSF111430,SUPERFAMILY--SSF57959

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 PF00170: bZIP_1" amino acids 62 to 115 (54 residues), 29.4 bits, see alignment 7.1e-11 PF08601: PAP1" amino acids 345 to 400 (56 residues), 24.8 bits, see alignment 1.8e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>mRNA_5778 HMMPfam-bZIP transcription factor-PF00170,HMMPfam-Transcription factor PAP1-PF08601,ProSitePatterns-Basic-leucine zipper (bZIP) domain signature.-PS00036,ProSiteProfiles-Basic-leucine zipper (bZIP) domain profile.-PS50217,SMART-basic region leucin zipper-SM00338,SUPERFAMILY--SSF111430,SUPERFAMILY--SSF57959 (Rhodosporidium toruloides IFO0880)
MSVQASTSAARPLVPALPAENGSQPPPKVGRTEEKQPKKRGRKRISEDLTNIKANDSLDA
DAKRKLQNRAAQRAFRERKEKHLADMEARVKVQDVELEELRQAIQSLVAENEALRRGEDP
PRTVLPASATREYPVPKGDSFSSPGSISSAPPHADRSASPIETKPVIARSPPIDSSLPHS
VSSVSQDSTFAPGPASFLPPTYSGPPAISASQLSPPVASVQPVPTAFQPLASGDIDINRL
DELNFDFDAPFDFSESLPLPPLFASLLDGFDLPGSATTESGSNATKITTVPSSATSEMDD
TCPGEDDDPPPLPNGRIPCDKPECDFTSVSCVLPIPWRPPTIAGDDKNLWVAQKCWAKLC
SHPLFSQCDTDELCQELRDKTRCSPDGRLVCHKGDVCDIFRSIPQKARIRQQQLSMQ