Protein Info for mRNA_5785 in Rhodosporidium toruloides IFO0880

Name: 14153
Annotation: K14758 HRR25 casein kinase I homolog HRR25

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF00069: Pkinase" amino acids 9 to 228 (220 residues), 90.4 bits, see alignment E=2e-29 PF07714: Pkinase_Tyr" amino acids 11 to 270 (260 residues), 49 bits, see alignment E=8.2e-17 PF17667: Pkinase_fungal" amino acids 120 to 206 (87 residues), 34.9 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 77% identical to HHP1_SCHPO: Casein kinase I homolog hhp1 (hhp1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K14758, casein kinase I homolog HRR25 [EC: 2.7.11.1] (inferred from 86% identity to uma:UM00584.1)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>mRNA_5785 K14758 HRR25 casein kinase I homolog HRR25 (Rhodosporidium toruloides IFO0880)
MDLRVGGKYRIGKKIGSGSVRDIYLGVNIISGEEVAIKLESVKAKHPQLEYEAKVYKTLA
GGVGVPFVRWFGVECDYNAMVLDLLGPSLEDLFNFCNRKFSLKTTLLLADQLISRIEYIH
SRNFIHRDIKPDNFLMGIGKRGNQVNVIDFGLAKKYRDPKTHLHIPYRENKNLTGTARYT
SINTHLGVEQSRRDDMESLGYVLMYFLRGSLPWQGLKAATKKQKYDRIMEKKMTTPTEYL
CRGFPNEFAIYLNYCRSLRFDDKPDYSYLRKLFRDLFVREGFQYDYVFDWSVQQRVDDVQ
KQQLEFQKQQAAGGAQPQSQQQPQGQSAAATAQPKRRVLQPGEVDQQGQGVPQSDQRMLR
SQTRNQQESRMRAGGEWY