Protein Info for mRNA_5791 in Rhodosporidium toruloides IFO0880

Name: 14159
Annotation: K15115 SLC25A32, MFT solute carrier family 25 (mitochondrial folate transporter), member 32

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 77 to 95 (19 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details PF00153: Mito_carr" amino acids 14 to 101 (88 residues), 73.7 bits, see alignment E=4.8e-25 amino acids 109 to 196 (88 residues), 66.4 bits, see alignment E=8.9e-23 amino acids 218 to 311 (94 residues), 65.9 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: K15115, solute carrier family 25 (mitochondrial folate transporter), member 32 (inferred from 52% identity to cnb:CNBG0540)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>mRNA_5791 K15115 SLC25A32, MFT solute carrier family 25 (mitochondrial folate transporter), member 32 (Rhodosporidium toruloides IFO0880)
MSSRDTPAVFGSPALDSAFCGVSAGIVSTICMQPLDLLKVQLQVSTAPKTHGTLGQIWWG
LGEIVRQGGYAGLYRGLTPNLVGNASSWGFYFLWYTMIKARMDGGEEKKLNAGQHLLASA
SSGVITAVITNPIWVVKTRMFTTRADETKAYRGVLNGLATLAREEGVRGMSKGMTLALIG
VSNGAIQFMTYEELKKRRVDLRRKRLGAGASEEEVKRLSNTEYILMSGSAKLVAIGITYP
YQVIRSRIQYRPVSAASSTPPYTSIPDVITRTYRSEGLSGFYKGIATNAVRILPGTCVTF
VVYEQLSRWLGRMAERSEAKGRGTAAEVQVS