Protein Info for mRNA_5817 in Rhodosporidium toruloides IFO0880

Name: 14185
Annotation: K09680 coaW type II pantothenate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 504 to 518 (15 residues), see Phobius details PF03630: Fumble" amino acids 44 to 265 (222 residues), 111.7 bits, see alignment E=2.3e-36 amino acids 342 to 546 (205 residues), 312.8 bits, see alignment E=1.5e-97 TIGR00555: pantothenate kinase" amino acids 347 to 545 (199 residues), 256.8 bits, see alignment E=1.6e-80

Best Hits

Predicted SEED Role

"Pantothenate kinase type II, eukaryotic (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>mRNA_5817 K09680 coaW type II pantothenate kinase (Rhodosporidium toruloides IFO0880)
MEDSQLPSPAGTQLLVDVRGAEIVSSNSEDPEVYLPHHEEMISHIAVDIGGSLAKVVYFT
RSSAREARPSANGIASPSPSSSPFVESPAQPATPIPSTSNQQPPQWEPRRTPSPPQPQQA
KPNGILGPKSLSHRPPSHSPSASSRAFHSRLRRRSSTSRFPTGGRLNFVKFETSDLSSLI
TYLETLISSSAQANRVPVEVMKRNVKIMATGGGAHKFYRQLRDALGIEVRREEEMECLVL
GLSFVMEIPNEVFWYSDELIQAVSHPQQRALSQVNIPSTPSSSAVPLPIPPNLDIPLPTT
PSVLASSTSASSLSIPSTPPLSADDLPRPSPNPPQYSLKFDSHPSPAQFPCLLVNIGSGV
SIVKIDDYGKFERISGTSLGGGTLWGLLSLLTGARSFDDMLALADKGDNSSVDMLVGDIY
GQDYQKIGLKSSTIASSFGKVFRRGEGGGVRGEDEDEEEERRKSFRPEDISRSLLYAISN
NIGQIAYMNAEKHNLDRIYFGGGFIRGHAATISTLSYAIRFWSKGTKRALFLRHEGYLGG
IGAWLKNIGAGAETPPQDGSGLGLRDGEVGSLVDAEEERRGR