Protein Info for mRNA_5828 in Rhodosporidium toruloides IFO0880

Name: 14196
Annotation: KOG0725 Reductases with broad range of substrate specificities

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00106: adh_short" amino acids 10 to 206 (197 residues), 177.9 bits, see alignment E=3.4e-56 PF08659: KR" amino acids 12 to 170 (159 residues), 43.1 bits, see alignment E=9.1e-15 PF13561: adh_short_C2" amino acids 16 to 258 (243 residues), 235.4 bits, see alignment E=1.4e-73

Best Hits

Swiss-Prot: 37% identical to UCPA_SALTI: Oxidoreductase UcpA (ucpA) from Salmonella typhi

KEGG orthology group: None (inferred from 71% identity to scm:SCHCODRAFT_83954)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>mRNA_5828 KOG0725 Reductases with broad range of substrate specificities (Rhodosporidium toruloides IFO0880)
MSATLRLPGKVCIITGAGAGIGLETALVFAQEGAHVVAADINEQAAQRTVETIQKQVNGA
AKAIAVKCDVSKEAEIKAMVAKAVEEFGKLDVIFNNAGIMHPQDDNALNTEERIWDLTMN
SNLKGVWWGCKYAIEAMLKNPKGGSIINTASFVALMGAATPQLAYTASKGAVLAMTRELA
MVHARDGIRLNSLCPGPLKTELLMSFLDTPEKKERRMVHIPMGRFGEAVEQAKAALFLAS
DDSSFITGTDFKVDGGISGCYVTPLGEPRVPGPQNLAPKA