Protein Info for mRNA_5893 in Rhodosporidium toruloides IFO0880

Name: 14261
Annotation: KOG1748 Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00517: acyl carrier protein
  • amino acids 43 to 116 (74 residues), 90.1 bits, E=3.3e-30
• PF00550: PP-binding
  • amino acids 48 to 114 (67 residues), 53.1 bits, E=1.7e-18

Best Hits

Swiss-Prot: 51% identical to ACPM_NEUCR: Acyl carrier protein, mitochondrial (nuo-12) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K03955, NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1 [EC: 1.6.5.3 1.6.99.3] (inferred from 65% identity to scm:SCHCODRAFT_64587)

Predicted SEED Role

"Acyl carrier protein" in subsystem Fatty Acid Biosynthesis FASII or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or mycolic acid synthesis

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3, 1.6.99.3

Use Curated BLAST to search for 1.6.5.3 or 1.6.99.3

Protein Sequence (121 amino acids)

>mRNA_5893 KOG1748 Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit (Rhodosporidium toruloides IFO0880)
MFRAAARSLVAPAARRVAVAPAPRLAPSLLAQRFYASSSLSQDTIKARIEDVLKSFEKVD
STKLTPTASFTNDLGLDSLDAVEVVMAIEEEFAIEIPDEEADRITTVGEAIDYISKTPEA
H