Protein Info for mRNA_5896 in Rhodosporidium toruloides IFO0880

Name: 14264
Annotation: K07573 CSL4, EXOSC1 exosome complex component CSL4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF14382: ECR1_N" amino acids 4 to 43 (40 residues), 38.4 bits, see alignment 8.5e-14 PF10447: EXOSC1" amino acids 93 to 130 (38 residues), 46.2 bits, see alignment 6.5e-16

Best Hits

Swiss-Prot: 44% identical to EXOS1_HUMAN: Exosome complex component CSL4 (EXOSC1) from Homo sapiens

KEGG orthology group: K07573, exosome complex component CSL4 (inferred from 50% identity to cnb:CNBD4680)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>mRNA_5896 K07573 CSL4, EXOSC1 exosome complex component CSL4 (Rhodosporidium toruloides IFO0880)
MAALVIPGQPLSSQTTGATLAAGPGTWTRGGQVYAALVGEVSREGGVLSVKGKEETQAIP
EPNAIVIGTVSRITRQAATLSLLTVDGRPCRPDFTGIIRSQDVRQTAKDSVKIWSCFRPG
DVVRAKVISLGDSRSYFLSTAANSLGVLFAVSTSTGEALEAVSWEEMRDPSTGEVESRKV
AGPE