Protein Info for mRNA_5907 in Rhodosporidium toruloides IFO0880

Name: 14275
Annotation: K02726 PSMA2 20S proteasome subunit alpha 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF10584: Proteasome_A_N" amino acids 10 to 32 (23 residues), 35.1 bits, see alignment (E = 8.6e-13) PF00227: Proteasome" amino acids 35 to 218 (184 residues), 190.4 bits, see alignment E=2.3e-60

Best Hits

Swiss-Prot: 63% identical to PSA2_SCHPO: Probable proteasome subunit alpha type-2 (pre8) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02726, 20S proteasome subunit alpha 2 [EC: 3.4.25.1] (inferred from 78% identity to scm:SCHCODRAFT_63403)

Predicted SEED Role

"proteasome subunit alpha2 (EC 3.4.25.1)" in subsystem Proteasome eukaryotic (EC 3.4.25.1)

Isozymes

Compare fitness of predicted isozymes for: 3.4.25.1

Use Curated BLAST to search for 3.4.25.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>mRNA_5907 K02726 PSMA2 20S proteasome subunit alpha 2 (Rhodosporidium toruloides IFO0880)
MSGPETGGRYSFSLTTFSPSGKLVQIEHALAAVGQGTTSLGIKATNGIVLATSKKAPSPL
VDDSMLEKVALICPNIGLVYSGMGPDFRVLVAKARKSAQAYWKIYGEYPSTRVMVGEIAT
VMQDATQSGGVRPFGVSLLVAGFDNARGHTLYQVDPSGSFWAWKASAIGKNQTNAKTFLE
KRYNDDLSLEDAIHTALLTLKEGFEGVMDEKTIELGIISTTPTEEGVATTGHGTGLSGAP
GFRKLTEAEVADYLQL