Protein Info for mRNA_5949 in Rhodosporidium toruloides IFO0880

Name: 14317
Annotation: K01046 E3.1.1.3 triacylglycerol lipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01046, triacylglycerol lipase [EC: 3.1.1.3] (inferred from 45% identity to act:ACLA_065480)

Predicted SEED Role

No annotation

MetaCyc Pathways

triacylglycerol degradation (2/3 steps found)
retinol biosynthesis (1/7 steps found)

KEGG Metabolic Maps

Glycerolipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>mRNA_5949 K01046 E3.1.1.3 triacylglycerol lipase (Rhodosporidium toruloides IFO0880)
MLKDKYRSPKLPLVFCHGLFGFDYIGPAGLKPLRFSYWVGVEEALAANGVEVMIGRVPAS
ASIEERAKVLCEMIGERFPGREVNLIGHSMGGLDGRYVISRLKPINFKIRSLTTISTPHR
GSSFADYLLEDVLGAERVPTLLSTMKALGVPGGGKAFDDLTTTKMARFNEETPDDPSVRY
FSFSAEFTPSWSNPFRIPWGVVYEREGPNDGLVSVESARWGDHKATLHNVNHADLIGWKG
VVRYAFAAWSGHEIRYAPVSFFLGVSEMLADEGF