Protein Info for mRNA_5957 in Rhodosporidium toruloides IFO0880

Name: 14325
Annotation: HMMPfam-Eukaryotic cytochrome b561-PF03188,ProSiteProfiles-Cytochrome b561 domain profile.-PS50939,SMART-Cytochrome b-561 / ferric reductase transmembrane domain.-SM00665,SUPERFAMILY--SSF49344

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details transmembrane" amino acids 298 to 322 (25 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details amino acids 452 to 472 (21 residues), see Phobius details PF16010: CDH-cyt" amino acids 98 to 248 (151 residues), 34 bits, see alignment E=2.4e-12 PF03188: Cytochrom_B561" amino acids 326 to 431 (106 residues), 31.7 bits, see alignment E=1.6e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>mRNA_5957 HMMPfam-Eukaryotic cytochrome b561-PF03188,ProSiteProfiles-Cytochrome b561 domain profile.-PS50939,SMART-Cytochrome b-561 / ferric reductase transmembrane domain.-SM00665,SUPERFAMILY--SSF49344 (Rhodosporidium toruloides IFO0880)
MGRIPGAQSRISRRYSCFSLFLFPLSRTRSTMLLLAATVLALAAAFATALTGPEVVAVFP
SSSSSLKGGTISLPRFDLSIISNGTHALYVANASSTSPTSVGWLGVGHGTAMGDADFLLA
WPTVSGSSVNWTLSHRLPNSNALGGHAMPVLASSSAGTSTSTFYTLVPALTTSDSSSPFS
SVAFTRLVDPGSTYPTAQGVTNAPLGSGTLDLIYASSSRNPGTPNEGQATFSQHNQPTGV
TSLDMSAAYAVAANATSTPPPQTQQAPPPSAAARRRRRIFIAHGAPTSPRSLSLHADAVG
AAALGGLAFAIIVPLAILTARFGRERFAWLPPHAALQLLAASMVITTFALAVSQTGNLFA
DLHQRLGLVLFLLVVLQLLLGYLAHFTLPSALTSCSPSLSRPRPSFARAIHILLGLTILA
LGWVQIHTGIKKGGEWYRATLGMEEVPRAVRGVFWTLVGLFVLAYVGEWVAAIRRGMRGG
KKVAANGEALPLHEAGEGGRKRSRRT