Protein Info for mRNA_5958 in Rhodosporidium toruloides IFO0880

Name: 14326
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 137 to 161 (25 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 251 to 275 (25 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 357 to 383 (27 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details amino acids 442 to 464 (23 residues), see Phobius details amino acids 470 to 495 (26 residues), see Phobius details amino acids 507 to 525 (19 residues), see Phobius details amino acids 537 to 557 (21 residues), see Phobius details PF07690: MFS_1" amino acids 250 to 518 (269 residues), 44.4 bits, see alignment E=5.5e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>mRNA_5958 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MLVLLLLRSAPRSLFSRLFFRVLAFCIDNDTSPSIQNTPQTQGSLILLLTPLHDTHSAMT
TRLDVEKGSSFADDEYGAHVVRSDTELEKDGGNLVLQVEDAAAAGLKTAKDGRTILVPQP
SDDPRDPLNWPEWKKHAILIIVALAAFGGDFQSGAGIPLLLSQGEEWGLSPAKVNEAGNL
NVLLLGIGGLVWIPPLYFWGRLPVLFWTQLLGTFMVLGSVLVQDFTAYYALRPLTSLFLT
AGQTIGLTKIGLWVVIFLCSPYCGPFFGGFIVSGLNGQWRPVLWVVFAWSCFVLLLIIFL
ADETWYDRSLPVQPERPTGIYGRFCNLVGITGIRQRAYKPNAFPSVMRLFEVFTKPTLWM
VFVVYALSFMWAVGINITSSIILATPKVAGGYGLTLKQTSVVYLTPLVALMLGEGIGHVA
NDWIANRYVRKHNGVFKPECRLYIFPFASVLMIAGLVLVGQALAKGLSVGAIVVGWGAYV
LGVMVSSVAITAYILDVFPSASGEVSAAVNLSRTISGFSVGYFQAPWGEAVGYDVSFGIQ
AAIVAFAMGLVFVLIAVGERIRKFGGPLHFAKHQ