Protein Info for mRNA_6049 in Rhodosporidium toruloides IFO0880

Name: 14417
Annotation: K08517 SEC22 vesicle transport protein SEC22

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 239 to 258 (20 residues), see Phobius details PF13774: Longin" amino acids 69 to 151 (83 residues), 87 bits, see alignment E=7.3e-29 PF00957: Synaptobrevin" amino acids 179 to 257 (79 residues), 50.2 bits, see alignment E=1.8e-17

Best Hits

KEGG orthology group: K08517, vesicle transport protein SEC22 (inferred from 64% identity to lbc:LACBIDRAFT_181880)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>mRNA_6049 K08517 SEC22 vesicle transport protein SEC22 (Rhodosporidium toruloides IFO0880)
MRSRRSCVVEEACHSSLRFLSATSPPRSASLAMVRSTIIARATDGLPLAASNDDDEQNDA
KLPEYKQQAKLIFRRLTPQSEPRCSIESGACTLHYLIADSIVYLVIADRSYPRKLAFSYL
AELATEFSRSYPPGMSLKPGLRPYAFVKFDTFIQRTKRLYLDPRGAEASGKGGPTASGLD
KLNEDLQDVTRIMTKNMEDLLWRGDSLDRMSTMSSSLRDESLKYRKAARKINVDAMIRKW
APIGVLGLFFFVFVWYRFW