Protein Info for mRNA_6121 in Rhodosporidium toruloides IFO0880

Name: 14489
Annotation: KOG3607 Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 PF13688: Reprolysin_5" amino acids 186 to 421 (236 residues), 111.4 bits, see alignment E=1.6e-35 PF13583: Reprolysin_4" amino acids 188 to 233 (46 residues), 24.8 bits, see alignment 4e-09 amino acids 291 to 437 (147 residues), 91 bits, see alignment E=2.2e-29 PF13574: Reprolysin_2" amino acids 208 to 432 (225 residues), 118.6 bits, see alignment E=8.8e-38 PF01421: Reprolysin" amino acids 293 to 420 (128 residues), 30 bits, see alignment E=1.3e-10 PF13582: Reprolysin_3" amino acids 298 to 382 (85 residues), 42.9 bits, see alignment E=1.7e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (584 amino acids)

>mRNA_6121 KOG3607 Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family (Rhodosporidium toruloides IFO0880)
MFTIHSTEQYLRTKDDLDPEPPLVTPLRRSRRAFGGADDAILLPRHPAMVIVRESAILSP
VEHISALRKRGLPLPDPTILSTASSCSHDSLPFNVDPAHPVYANSHHALDTYSNSSSLSS
PWLSFPSSPSIQPFTPADHSTSFNSYRYVPSDRHRKRQGDDISGGSGSSSNFINSIGSTT
GCPKQNVVLFVGVAADCTYTTTQRSSDAARQQILSNFNSVSALYQRSFNVSLSAQYPSSL
ALPSQTCPVCLAGIIKLAVMNLTCPSLSSQVDPSNPWNLLCQSGSTGRAGSSIGVDLNTR
LSIFSQWRGDKGAQDGAGLWHLLTKCQTGSEVGVAWLGQLCRTASSSQGGQTTSCTGVTA
ATRSEWQVIAHEIGHNFGAIHDCASGCSLSGNCCLLLSLTLHVSANYIMSPVSEKNVSSF
SPCSVGNICTTLSSSLNTTCLATRRTREASGRRTSEIGNAPPSADNSSPLRPLPHAPPST
TTGSTVAKLPFCAACKPALPPSTPTEPSSTRLAILSADAARKKTVNISLSLARYMMTPAN
RSSDTSAFAKPPPPAPSSATHSTATPSSSPSHQLLSAAGNHADS