Protein Info for mRNA_6177 in Rhodosporidium toruloides IFO0880

Name: 14545
Annotation: K00868 pdxK, pdxY pyridoxine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR00687: pyridoxal kinase" amino acids 9 to 269 (261 residues), 172.2 bits, see alignment E=8.2e-55 PF08543: Phos_pyr_kin" amino acids 88 to 194 (107 residues), 34.7 bits, see alignment E=6.5e-13

Best Hits

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>mRNA_6177 K00868 pdxK, pdxY pyridoxine kinase (Rhodosporidium toruloides IFO0880)
MAQANVTQEKRILSIQSHVVCGYVGNKSASFPLQLLGWEVDAALTVSFSNHTVRYGRWGG
SKFDAAHLEDVFSALDANGLLRQSHVLTGYVPGADALKVVVLAVDRLRAINPSLVYILDP
VMGDDGRIYVSESVIPIYKALLPRATCATPNYFEAELLTDIKILDATSLQLALRTFHERY
RIPNIVVSAVSLPLSELVKLGFVDAPALTTSSSTSRMLVCAGSTLVSAPGEPLKTTSFGI
AFPELAEHYEGVGDVFSALVAGRFPSASDPAFAAHPISPLARTVELAIASLQGILAKTRQ
HALSLAKGRADLIVPREGESAEERVRRLRTVELRLVQSQQEILNPDVKHRAVRFSGV