Protein Info for mRNA_6207 in Rhodosporidium toruloides IFO0880

Name: 14575
Annotation: KOG2711 Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 signal peptide" amino acids 1 to 48 (48 residues), see Phobius details PF07479: NAD_Gly3P_dh_C" amino acids 116 to 188 (73 residues), 43 bits, see alignment E=2.9e-15

Best Hits

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.94

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>mRNA_6207 KOG2711 Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase (Rhodosporidium toruloides IFO0880)
MLPFRPGHALSMSPCYRPPRQRSHSLPLALVPPFLLRFARQFRWASAQQIPTHCDRETRG
YRCLSRLIKAGHSTSASRITKLYGDYRPPGLTCARQRDARCARFLLLLPEQLPTLSRRNS
KCAEASVTSGKTFDKLEKELLNGQKLQGVATAEEIYTFLKARERLDGYPLFTKVYQICKR
MIEPEAIFEGV