Protein Info for mRNA_6222 in Rhodosporidium toruloides IFO0880

Name: 14590
Annotation: K07088 K07088 uncharacterized protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 395 to 419 (25 residues), see Phobius details amino acids 442 to 465 (24 residues), see Phobius details amino acids 484 to 504 (21 residues), see Phobius details amino acids 524 to 546 (23 residues), see Phobius details amino acids 576 to 601 (26 residues), see Phobius details PF03547: Mem_trans" amino acids 15 to 160 (146 residues), 42.3 bits, see alignment E=1.8e-15 amino acids 343 to 508 (166 residues), 32.1 bits, see alignment E=2.2e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (604 amino acids)

>mRNA_6222 K07088 K07088 uncharacterized protein (Rhodosporidium toruloides IFO0880)
MSSIPSTNVLIWLSVKPLIKLVIPAGLGFWLTRAGVFPVPASRGASVLILNVFLPNLLFS
KIVPSITPENAKAIGPIFLVGFVYIIISLVLGVLVRVTFRTPRNFRWGILAAATWSNWGD
LPTSVVQTVCASAPFAGVQDSNLAIAYVAIFILIFYITLFPMRGIHLIERDYTHPPPPLA
DDEQEKGALDKYRRACSKVGGFVRRRGKRSGLGLDGEESIVGEKAATPALDELHKVASTA
SQRRYPQATFSPLHRQTTSRSIDRSSIREIASAAHAASPADTPGQLASTAPDGPARRRLL
QLERERLRTIVGSPAGSVVDDEITEVGTQSATKEVEVADEKAGARLNSVGSLDKSAVTKE
TAKAEDMKEIADAADDEEAEEATGVRRFLISVKGFALSLLTPPTISLVAALVCALVKPLK
ALFTTVPDYSWHPTAPDGNPPLAILLDTATFIGNGSVPLGLMVLGSTLGRMRIPRPISRL
PLGSIFALALAKVVLLPIIGFVFVRGLATHTGLVNKDNHVLQFVMIYFSVCPTATTQCAL
TVVRCALSVRRSPRTDDFFSQIFAPEDGESNADILAAYLIAQYLIFAFASVVLTAISLNS
IFSS