Protein Info for mRNA_6223 in Rhodosporidium toruloides IFO0880

Name: 14591
Annotation: BLAST acetyl-coenzyme A synthetase [Rhizoctonia solani AG-1...

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Predicted SEED Role

"Acetyl-coenzyme A synthetase (EC 6.2.1.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 6.2.1.1)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• acetate conversion to acetyl-CoA (1/1 steps found)
• chitin deacetylation (3/4 steps found)
• L-isoleucine biosynthesis V (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• superpathway of acetate utilization and formation (2/3 steps found)
• reductive glycine pathway (6/9 steps found)
• adlupulone and adhumulone biosynthesis (1/6 steps found)
• colupulone and cohumulone biosynthesis (1/6 steps found)
• lupulone and humulone biosynthesis (1/6 steps found)
• cis-geranyl-CoA degradation (1/9 steps found)
• superpathway of bitter acids biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.1

Use Curated BLAST to search for 6.2.1.1

Protein Sequence (63 amino acids)

>mRNA_6223 BLAST acetyl-coenzyme A synthetase [Rhizoctonia solani AG-1... (Rhodosporidium toruloides IFO0880)
MFIDAAFLPLLCWVGAGRPAAASAKLQRKISANEADQLGDLSTLADPSVVDQIKEKFASV
PAK