Protein Info for mRNA_6232 in Rhodosporidium toruloides IFO0880

Name: 14600
Annotation: K17450 ACO2 homoaconitase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01340: aconitate hydratase, mitochondrial
  • amino acids 42 to 812 (771 residues), 1098.2 bits, E=0
• PF00330: Aconitase
  • amino acids 64 to 525 (462 residues), 475.7 bits, E=1.9e-146
• PF00694: Aconitase_C
  • amino acids 619 to 745 (127 residues), 127.1 bits, E=5.6e-41

Predicted SEED Role

"Aconitate hydratase (EC 4.2.1.3)" in subsystem Propionate-CoA to Succinate Module or Serine-glyoxylate cycle or TCA Cycle (EC 4.2.1.3)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (13/14 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• glyoxylate cycle (6/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• nitrogen remobilization from senescing leaves (5/8 steps found)
• reductive TCA cycle I (7/11 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• mixed acid fermentation (9/16 steps found)
• reductive TCA cycle II (5/12 steps found)
• methylaspartate cycle (9/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.3

Use Curated BLAST to search for 4.2.1.3

Protein Sequence (824 amino acids)

>mRNA_6232 K17450 ACO2 homoaconitase (Rhodosporidium toruloides IFO0880)
MLHARRPLQRVANARLSRSLATHTSSYPPPPPRDFKSITPPYPHLLRQLEQVRKVLNRPL
SLAEKIVYSHLVNVEEGLAGGDPIRGEKHLKLRPDRVALQDASAQMAILQFSTCGREATA
VPVSIHCDHLISAYEGAEADLKRSIMSNKEVFDFLESAAKKYGIEFWGPGSGIIHQIVLE
NYSAPGLLMLGCDSHTPNAGGLGAIAIGVGGADAVDAMTATPWELKAPKLIGVELRGELS
GWCSAKDVILEVVGRLSVRGGTGSIIEYYGEGVKRMGATGLATIANMGAEMGATTSTFPY
SDNMRRYLHATNRGPVADEADKAQAAGFLSPDKGCEYDQHVSIDLSTLEPKLNGPFTPDL
STPLSKFGGLVKEKGWKDELSAALIGSCTNSSYEDMARAASIARQAKAKGLSVKSSFMVT
PGCVLVPFALLMQSSDRSVFRSSELINATIERDGLKADLEAVGGQVLANACGPCIGQWER
EEKKGEENAILTSFNRNFKARNDGNRLTMNFLASPDIVTAMAFSGKLSFDPRHDELLDSE
GKPFKFDPPTGDKLPQSGFTAGNTTYLPRPTPEPVPSTPLAISPTSTRLELLAPFEPHFP
PEAFADSTKKLEFDDLRCLLRIRGKCTTDEISAAGKWLKYKGHLSNLAENTLIGATNDQT
GRVNSAIDFESGEEGTIPEVAKKYKARGQPWMIVTDHNYGEGSAREHASLQPRFLNCKVI
LARSFARIHRTNLTKQGVLPLTFANDADYSLIDAGDVVSTRGLDDLLRGNLNADVDVVVK
KADGSEKVIKTVHGLSKDQVEWIREGSALNLIKRKAAEEKAGQA