Protein Info for mRNA_6247 in Rhodosporidium toruloides IFO0880

Name: 14615
Annotation: K01551 arsA, ASNA1 arsenite-transporting ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF02374: ArsA_ATPase" amino acids 29 to 325 (297 residues), 363 bits, see alignment E=2.5e-112 PF01656: CbiA" amino acids 31 to 197 (167 residues), 46.2 bits, see alignment E=9.4e-16 TIGR00345: transport-energizing ATPase, TRC40/GET3/ArsA family" amino acids 32 to 324 (293 residues), 316.6 bits, see alignment E=9.7e-99 PF13614: AAA_31" amino acids 34 to 156 (123 residues), 43.4 bits, see alignment E=7.2e-15

Best Hits

Swiss-Prot: 90% identical to GET3_RHOGU: ATPase GET3 (GET3) from Rhodotorula glutinis

KEGG orthology group: K01551, arsenite-transporting ATPase [EC: 3.6.3.16] (inferred from 74% identity to cne:CNK02640)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>mRNA_6247 K01551 arsA, ASNA1 arsenite-transporting ATPase (Rhodosporidium toruloides IFO0880)
MSTAYICAEPESDSLEPSLQNILDQDTLKWIFVGGKGGVGKTTTSCSLAVQLAKVRDSVL
LISTDPAHNLSDAFSQKFGKEASKVNGFTNLYAMEIDPSASMQDMVESGDDSGMNGMMQD
LAFAIPGIDEAMGFAEVMKHVKSMEFSVIVFDTAPTGHTLRFLSFPSVLEKALAKLSGLS
GRFGPMLNQIGSMMGGGLNTSEMFEKLESMRTVVTEVNAQFKNPDLTTFIPVMISEFLSL
YETERLIQELTQYQIDVHAIVVNQLLYPEENSSCKHCQVRWKQQQKYLKEAYELYAEDFH
IVRMPLLSQEVRGTEALKKFSELLIHPYKQGDEVVLS