Protein Info for mRNA_6288 in Rhodosporidium toruloides IFO0880

Name: 14656
Annotation: KOG0876 Manganese superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 1 to 78 (78 residues), 70.4 bits, E=1.5e-23
• PF02777: Sod_Fe_C
  • amino acids 96 to 196 (101 residues), 94.7 bits, E=3.5e-31

Best Hits

Swiss-Prot: 44% identical to SODM1_ARATH: Superoxide dismutase [Mn] 1, mitochondrial (MSD1) from Arabidopsis thaliana

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 44% identity to cne:CNI01590)

Predicted SEED Role

No annotation

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (196 amino acids)

>mRNA_6288 KOG0876 Manganese superoxide dismutase (Rhodosporidium toruloides IFO0880)
LPPLPYAYNALDPFIIEDITRLHHDVGHLAHVTALNLAVANMSTAIQCGNIEEVVRITES
LAFNGGGHINHSLFWRSLAPAASSSSNGTGGLFPTSGALHDHVSTSFGSVEQLSAVMVTA
GSGIRGSGWVWATEASSRLQLEVITTANQNLPFAWQVPILGIDCFEHAYLLQYKTNRLEY
LKSVFAVVNWQEAEAR