Protein Info for mRNA_6299 in Rhodosporidium toruloides IFO0880

Name: 14667
Annotation: K14574 SDO1, SBDS ribosome maturation protein SDO1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR00291: rRNA metabolism protein, SBDS family" amino acids 5 to 228 (224 residues), 197.8 bits, see alignment E=8.6e-63 PF01172: SBDS" amino acids 9 to 95 (87 residues), 112.6 bits, see alignment E=7.6e-37 PF09377: SBDS_C" amino acids 103 to 221 (119 residues), 123 bits, see alignment E=6.4e-40

Best Hits

Swiss-Prot: 55% identical to SBDS_XENLA: Ribosome maturation protein SBDS (sbds) from Xenopus laevis

KEGG orthology group: K14574, ribosome maturation protein SDO1 (inferred from 62% identity to uma:UM05434.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>mRNA_6299 K14574 SDO1, SBDS ribosome maturation protein SDO1 (Rhodosporidium toruloides IFO0880)
MPHIIKLTNVSVVRLKKGGKRFEVATYKNTVRSWRSGAQTDLSEVIQIDNVFTNVSKGAV
ASADELQKAFGTTDRTEIMMQILKKGELQVGEKERAVELEELRREICTEVAARCVDPNTQ
RPHTVGMIEKAMNEVGYNVNGSKAAKAQALDLIKVLQAKKTLPIARAQMRVRITMSSKEG
KKIKEKVLPLIAKVEEDEWSDEWELVALIDPGSFRLIDDLLQKEVKGAKKIETMSFSAVE
DEARIE