Protein Info for mRNA_6368 in Rhodosporidium toruloides IFO0880

Name: 14736
Annotation: KOG2049 Translational repressor MPT5/PUF4 and related RNA-binding proteins (Puf superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF00806: PUF" amino acids 15 to 36 (22 residues), 22.4 bits, see alignment (E = 7.2e-09) amino acids 51 to 82 (32 residues), 23.3 bits, see alignment (E = 3.7e-09) amino acids 85 to 120 (36 residues), 29 bits, see alignment 6e-11 amino acids 126 to 155 (30 residues), 31 bits, see alignment (E = 1.3e-11) amino acids 161 to 191 (31 residues), 33 bits, see alignment (E = 3.2e-12) amino acids 198 to 221 (24 residues), 21.5 bits, see alignment (E = 1.4e-08) amino acids 270 to 298 (29 residues), 20 bits, see alignment (E = 4.3e-08)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>mRNA_6368 KOG2049 Translational repressor MPT5/PUF4 and related RNA-binding proteins (Puf superfamily) (Rhodosporidium toruloides IFO0880)
MGANRFAGLRLEDLQGDMLSLCKDQFGCRYLQKKLEDGNPEHRDMIYNEVFPHFAELMSD
PFANYLAQRLLEHATDEQRDALIESISGELVTISLNMHGTRAVQKMIDCLSTRRQVQSLI
LALNLNVVTLIKDLNGNHVIQKCLNALPPEDNQFIYNAVATHCIEVATHRHGCCVLQRCI
DHASESQRIQLVTEITYNSLTLVQDAFGNYVVQYVLDLNDNRFIEAIVRQFLGNVSALSA
QKFSSNVVEKCIRVADATGRRAIIDELLVKNRLERLLRDSFANYVVQTALDYAEPAQRAQ
LVETIRPILPMIRNTPYGKRIQSKIQRETNEHMGHRGGYHHHGHGHHQAFIPAGGYYGVP
TFNGPPPHYPPHLAHGMHAPPPHAFGEYARAGSPYLGQFAGYPPAMLGGPMGAGPNGSLP
GGPGAAGQQAGAGFAPYAQAGPGAGDFAAPSSQNAHGGLPSAAGYATFAM