Protein Info for mRNA_6385 in Rhodosporidium toruloides IFO0880

Name: 14753
Annotation: K03107 SRP68 signal recognition particle subunit SRP68

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 PF16969: SRP68" amino acids 25 to 596 (572 residues), 274.5 bits, see alignment E=1.3e-85

Best Hits

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (670 amino acids)

>mRNA_6385 K03107 SRP68 signal recognition particle subunit SRP68 (Rhodosporidium toruloides IFO0880)
MASPDVQMNFPLLKLVSDARLTYGLRHQDYARYRSHCVAKVHYLRKSVGLAQTAGKSRKY
QKKDVVADKVASDKHLQIVLFDAERCWAYSQQLKESLADPATPPTTRHLLVKRLGKAVSL
SKDLVALAQSPELSSRLSASHVAQIHAYHLVMDGSLAFERGKHDAGLKSLSIAFEVLGKL
ASTAASATDEALANEMMDEVEPMLRFCAYKLGKDTAAGVAPIAEEVAEQEMATAVPGWEE
LSQRLEEKGKQGEKESVEITWRGETIPVRNAELVAAAVKVRDALATLKQDQTTARKAEVA
QGKQKEGKKEILGTKRMGTYDKALLVLGEAETMASQLVEDNKIARSKGNTARFEASSRPL
TLFHTYVQYHLLSIRIKRDLLVVSSASSKLAAREAKIRHVEQTYIARTETRNPAVADGKT
RRLLAKTYPGLVKVFDTILLSLEAMRDMEVVEQDDELASTVESRIAFVRAQRCMYLSRGY
GLASSFPSSLSLNARAKLYARQSRSTVQSLSSAFGTPDHDDEERDHDFIVDQLPLDDESF
DALDRELEADYDRISKEWFEATGGKVGENADEEDDVAAGVRDLSLAGSAKDKQKRKAKVP
FYDVAFNYVTAFDLDAMAVKAGLVAAPAEAAATTAPAQVKDEAKAAVGAKEEEEPQPAKR
GWGFGLFGRR