Protein Info for mRNA_6488 in Rhodosporidium toruloides IFO0880

Name: 14856
Annotation: K01655 LYS21, LYS20 homocitrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF00682: HMGL-like" amino acids 68 to 326 (259 residues), 268.7 bits, see alignment E=3e-84 TIGR02146: homocitrate synthase" amino acids 69 to 414 (346 residues), 520.7 bits, see alignment E=9.6e-161

Best Hits

Swiss-Prot: 79% identical to HOSM_SCHPO: Homocitrate synthase, mitochondrial (lys4) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01655, homocitrate synthase [EC: 2.3.3.14] (inferred from 81% identity to ppl:POSPLDRAFT_89192)

MetaCyc: 76% identical to homocitrate synthase (Saccharomyces cerevisiae)
Homocitrate synthase. [EC: 2.3.3.14]

Predicted SEED Role

"Homocitrate synthase (EC 2.3.3.14)" in subsystem Nitrogen fixation (EC 2.3.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>mRNA_6488 K01655 LYS21, LYS20 homocitrate synthase (Rhodosporidium toruloides IFO0880)
MCPSAASTSADPAPVPTTEGAVPPEFTPVDTHAPSQPEVVAAKNGTTPQHNPYAPRASDF
LSNVSNWKIIESTLREGEQFANAFFDTETKMKIAQALSDFGVEYIELTSPAASEQSREDC
KKICQMGLKSKILTHIRCHMDDARIAVETGVDGVDIVIGTSSFLRKYSHGKDITYIIKSA
IEVIEFVKSKGIEVRFSSEDSFRSDLVDLLSIYRAVDKIGVNRVGIADTVGCANPRQVYE
LVRTLRGVVSCDIECHFHDDSGCAVANAFCALEAGATHIDTSVLGIGERNGITTLGGLIA
RMYVVNPDYVKSKYNLAMLREVENLVADAVQVSVPFNNPITGFCAFTHKAGIHAKAILAN
PSTYEILKPEDFGMSRYIDIGSRLTGWNAVKSRVEQLELELTDEQVKDVTAKIKELADVR
TQSMDDVDTVLRVYHKHVSSGALGLRQPARFDELLAEHKSQNGSEAGDEPAAKKQKTSA