Protein Info for mRNA_6500 in Rhodosporidium toruloides IFO0880

Name: 14868
Annotation: K14416 HBS1 elongation factor 1 alpha-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF00009: GTP_EFTU" amino acids 48 to 251 (204 residues), 149.1 bits, see alignment E=2.4e-47 PF01926: MMR_HSR1" amino acids 53 to 166 (114 residues), 26 bits, see alignment E=1.7e-09 PF03144: GTP_EFTU_D2" amino acids 296 to 360 (65 residues), 31.9 bits, see alignment E=3e-11 PF03143: GTP_EFTU_D3" amino acids 368 to 426 (59 residues), 31.9 bits, see alignment E=2.8e-11

Best Hits

Swiss-Prot: 44% identical to EF1A_IGNH4: Elongation factor 1-alpha (tuf) from Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)

KEGG orthology group: K14416, elongation factor 1 alpha-like protein (inferred from 50% identity to mgl:MGL_3004)

Predicted SEED Role

"HBS1 protein" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>mRNA_6500 K14416 HBS1 elongation factor 1 alpha-like protein (Rhodosporidium toruloides IFO0880)
MEAMGLGDGSSSREEERMKVDEEPAPAIIMSKEKILKEVKAKAATEKPVLSLVVIGHVDA
GKSTLMGRVLHELGETTDREVASNQRQSEKIGKGSFAYAWTFDAMDEERERGVTIDVAID
TFSTQRKRFTLIDAPGHRDFVPNMISGAAQADVAILVVDGASGAFEKGFEGGGQTREHAL
LVRSLGVQQIIVAVNKLDAVRWSEVRYKNIFDQLFPFLTDIGFMPHKITFVPVSASTGEN
LTKQTNELLRAWYDGPTLVEELDSLPVPTRALDVALRIPVSNVFKGQSATASGLAVTGRV
ESGIVQVGEKLAALPGDESGIVRALEVNGELVPYATAGANATIFLSGIEANQLSVGSVLC
PRSQPVPVVSTFTAQVLVFEPKHPITAGYAVELFHHSRDIPASIVALEAMLDKTTGKVTK
TSPRCVRFP