Protein Info for mRNA_6502 in Rhodosporidium toruloides IFO0880

Name: 14870
Annotation: K02971 RP-S21e, RPS21 small subunit ribosomal protein S21e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 86 PF01249: Ribosomal_S21e" amino acids 1 to 79 (79 residues), 140.4 bits, see alignment E=8.4e-46

Best Hits

Swiss-Prot: 68% identical to RS21_CANAX: 40S ribosomal protein S21 (RPS21) from Candida albicans

KEGG orthology group: K02971, small subunit ribosomal protein S21e (inferred from 70% identity to pic:PICST_38424)

Predicted SEED Role

"SSU ribosomal protein S21e"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (86 amino acids)

>mRNA_6502 K02971 RP-S21e, RPS21 small subunit ribosomal protein S21e (Rhodosporidium toruloides IFO0880)
MQNDQGQVVDLYVPRKCSATNRLIIAKDHASVQINVAEVDESGKMTGSNVTYAFCGSVRE
TGDADESLNRLATQDGLLKNVFQYAQ