Protein Info for mRNA_6510 in Rhodosporidium toruloides IFO0880

Name: 14878
Annotation: K00818 E2.6.1.11, argD acetylornithine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00707: transaminase, acetylornithine/succinylornithine family" amino acids 69 to 488 (420 residues), 420 bits, see alignment E=3.9e-130 PF00202: Aminotran_3" amino acids 76 to 488 (413 residues), 322.7 bits, see alignment E=1.5e-100

Best Hits

Predicted SEED Role

"Acetylornithine aminotransferase (EC 2.6.1.11)" in subsystem Arginine Biosynthesis extended (EC 2.6.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>mRNA_6510 K00818 E2.6.1.11, argD acetylornithine aminotransferase (Rhodosporidium toruloides IFO0880)
MLSRLSARGAVAAARPAPFSSAVKGKAFATSACTQASAKACTDYLEPTHLDDSIPADVKA
KLAKHASVTLNTYARPPFILTRGKGLKLWDSHDREYLDFSGGIAVNALGHADEGVAKVLQ
DQSRKLVHVANLWHNEWSGELAHLLVQKTKEFGGLGYPAGQAEANGKAEDGGLKVFFTNS
GTESNEGALKFIRKYGKHVSAMRNAQGAEKGVAAPTDEKVEIVSFRDGFHGRSMGALSAT
WQPKYQLPFAPLVPSFVPATMNDIDSINQVVTEKTCGVILEPIQGEGGILEAKEDFLRAL
RRRCDEVGALLVFDEIQCGLGRTGSFWAHGSMPVDCHPDIVTMAKPLANGVPIGAIMMKD
KVADVIKLGDHGTTFGGQPLQTRVAHHVVSRIAAPSFLSNVSSVGDSLKARLANVHALFP
RLVAGPPRGRGLILGLPLTRDEYVQKVVKLMRERGVLVLSCGRQTVRFVPSLIATEADVE
KVVDVLESSLVVLNRQEEGL